PSMG1 Rabbit Polyclonal Antibody

CAT#: TA338920

Rabbit Polyclonal Anti-PSMG1 Antibody

Product Images

WB Suggested Anti-PSMG1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: MCF7 cell lysate.PSMG1 is supported by BioGPS gene expression data to be expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PSMG1 antibody: synthetic peptide directed towards the middle region of human PSMG1. Synthetic peptide located within the following region: TILTCRHVTDYKTSESTGSLPSPFLRALKTQNFKDSACCPLLEQPNIVHD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: proteasome assembly chaperone 1
• Database Link:
  NP_982257
  Entrez Gene 8624 Human
  UniProt ID O95456
• Background: PSMG1 is a chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG2. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization.
• Synonyms: C21LRP; DSCR2; LRPC21; PAC-1; PAC1
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 92%; Mouse: 92%; Dog: 85%; Pig: 85%; Horse: 85%; Bovine: 85%; Guinea pig: 85%; Rabbit: 77%