CCDC116 Rabbit Polyclonal Antibody

CAT#: TA338887

Rabbit Polyclonal Anti-CCDC116 Antibody

Product Images

Host: Rabbit; Target Name: CCDC116; Sample Tissue: SH-SYSY Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CCDC116 antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC116. Synthetic peptide located within the following region: VQQEPATHTAQDQATEPCRSLYTNLPASRQLSPLEPKLYMSACTGMGSSP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 67 kDa
• Gene Name: coiled-coil domain containing 116
• Database Link:
  NP_689825
  Entrez Gene 164592 Human
  UniProt ID Q8IYX3
• Background: The function of this protein remains unknown.
• Synonyms: FLJ36046
• Note: Immunogen Sequence Homology: Human: 100%