OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PIWIL4 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA338844
Rabbit Polyclonal Anti-PIWIL4 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
2 Weeks*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY407533 Transient overexpression lysate of piwi-like 4 (Drosophila) (PIWIL4) (as WB positive control) 100 ug
$436.00
TP306117 Recombinant protein of human piwi-like 4 (Drosophila) (PIWIL4), 20 µg
20 ug
$737.00

View other "PIWIL4 or NM_152431" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PIWIL4 antibody: synthetic peptide directed towards the N terminal of human PIWIL4. Synthetic peptide located within the following region: SGRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSR
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 96 kDa
Gene Name piwi like RNA-mediated gene silencing 4
Database Link
Background PIWIL4 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells.PIWIL4 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells (Sasaki et al., 2003 PubMed 12906857). supplied by OMIM
Synonyms HIWI2; MIWI2
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Categories Intracellular Proteins
Protein Pathways Dorso-ventral axis formation
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products