IQCF1 Rabbit Polyclonal Antibody

CAT#: TA338836

Rabbit Polyclonal Anti-IQCF1 Antibody

Product Images

WB Suggested Anti-IQCF1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IQCF1 antibody: synthetic peptide directed towards the middle region of human IQCF1. Synthetic peptide located within the following region: ATKIKAWWRGTLVRRALLHAALSACIIQCWWRLILSKILKKRRQAALEAF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: IQ motif containing F1
• Database Link:
  NP_689610
  Entrez Gene 132141 Human
  UniProt ID Q8N6M8
• Background: The exact function of IQCF1 is not known.
• Synonyms: FLJ27508; MGC39725
• Note: Immunogen Sequence Homology: Human: 100%