KCNRG Rabbit Polyclonal Antibody

SKU TA338773

Rabbit Polyclonal Anti-KCNRG Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KCNRG antibody: synthetic peptide directed towards the middle region of human KCNRG. Synthetic peptide located within the following region: DTLLKEGFHLVSTRTVSSEDKTECYSFERIKSPEVLITNETPKPETIIIP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 31 kDa
• Gene Name: potassium channel regulator
• Database Link:
  NP_775876
  Q8N5I3
• Background: This gene encodes a protein which regulates the activity of voltage-gated potassium channels. This gene is on chromosome 13 and overlaps the gene for tripartite motif containing 13 on the same strand. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012]
• Synonyms: DLTET
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Rabbit: 92%; Bovine: 86%

Reference Data