KCNRG (NM_173605) Human Recombinant Protein
SKU
TP307143
Recombinant protein of human potassium channel regulator (KCNRG), transcript variant 1, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC207143 protein sequence
Red=Cloning site Green=Tags(s) MSSQELVTLNVGGKIFTTRFSTIKQFPASRLARMLDGRDQEFKMVGGQIFVDRDGDLFSFILDFLRTHQL LLPTEFSDYLRLQREALFYELRSLVDLLNPYLLQPRPALVEVHFLSRNTQAFFRVFGSCSKTIEMLTGRI TVFTEQPSAPTWNGNFFPPQMTLLPLPPQRPSYHDLVFQCGSDSTTDNQTGVRYVSIKPDNRKLANGTNV LGLLIDTLLKEGFHLVSTRTVSSEDKTECYSFERIKSPEVLITNETPKPETIIIPEQSQIKK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_775876 |
Locus ID | 283518 |
UniProt ID | Q8N5I3 |
Cytogenetics | 13q14.2 |
RefSeq Size | 1527 |
RefSeq ORF | 816 |
Synonyms | DLTET |
Summary | This gene encodes a protein which regulates the activity of voltage-gated potassium channels. This gene is on chromosome 13 and overlaps the gene for tripartite motif containing 13 on the same strand. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH307143 | KCNRG MS Standard C13 and N15-labeled recombinant protein (NP_775876) | 10 ug |
$3,255.00
|
|
PH312086 | KCNRG MS Standard C13 and N15-labeled recombinant protein (NP_955751) | 10 ug |
$3,255.00
|
|
LC403557 | KCNRG HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC404578 | KCNRG HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY403557 | Transient overexpression lysate of potassium channel regulator (KCNRG), transcript variant 1 | 100 ug |
$436.00
|
|
LY404578 | Transient overexpression lysate of potassium channel regulator (KCNRG), transcript variant 2 | 100 ug |
$436.00
|
|
TP312086 | Recombinant protein of human potassium channel regulator (KCNRG), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.