KCNRG (NM_173605) Human Mass Spec Standard

SKU
PH307143
KCNRG MS Standard C13 and N15-labeled recombinant protein (NP_775876)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207143]
Predicted MW 31 kDa
Protein Sequence
Protein Sequence
>RC207143 protein sequence
Red=Cloning site Green=Tags(s)

MSSQELVTLNVGGKIFTTRFSTIKQFPASRLARMLDGRDQEFKMVGGQIFVDRDGDLFSFILDFLRTHQL
LLPTEFSDYLRLQREALFYELRSLVDLLNPYLLQPRPALVEVHFLSRNTQAFFRVFGSCSKTIEMLTGRI
TVFTEQPSAPTWNGNFFPPQMTLLPLPPQRPSYHDLVFQCGSDSTTDNQTGVRYVSIKPDNRKLANGTNV
LGLLIDTLLKEGFHLVSTRTVSSEDKTECYSFERIKSPEVLITNETPKPETIIIPEQSQIKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_775876
RefSeq Size 1527
RefSeq ORF 816
Synonyms DLTET
Locus ID 283518
UniProt ID Q8N5I3
Cytogenetics 13q14.2
Summary This gene encodes a protein which regulates the activity of voltage-gated potassium channels. This gene is on chromosome 13 and overlaps the gene for tripartite motif containing 13 on the same strand. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012]
Write Your Own Review
You're reviewing:KCNRG (NM_173605) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH312086 KCNRG MS Standard C13 and N15-labeled recombinant protein (NP_955751) 10 ug
$3,255.00
LC403557 KCNRG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404578 KCNRG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403557 Transient overexpression lysate of potassium channel regulator (KCNRG), transcript variant 1 100 ug
$436.00
LY404578 Transient overexpression lysate of potassium channel regulator (KCNRG), transcript variant 2 100 ug
$436.00
TP307143 Recombinant protein of human potassium channel regulator (KCNRG), transcript variant 1, 20 µg 20 ug
$737.00
TP312086 Recombinant protein of human potassium channel regulator (KCNRG), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.