CHRFAM7A Rabbit Polyclonal Antibody

CAT#: TA338731

Rabbit Polyclonal Anti-CHRFAM7A Antibody

Product Images

Host: Rabbit; Target Name: CHRFAM7A; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0 ug/ml

• 

  WB Suggested Anti-CHRFAM7A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: 293T cell lysate CHRFAM7A is supported by BioGPS gene expression data to be expressed in HEK293T

• 

  Host: Rabbit; Target Name: CHRFAM7A; Sample Tissue: 721_B; Antibody Dilution: 1.0 ug/ml; CHRFAM7A is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CHRFAM7A antibody: synthetic peptide directed towards the middle region of human CHRFAM7A. Synthetic peptide located within the following region: QRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: CHRNA7 (exons 5-10) and FAM7A (exons A-E) fusion
• Database Link:
  NP_683709
  Entrez Gene 89832 Human
  UniProt ID Q494W8
• Background: The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The family member CHRNA7, which is located on chromosome 15 in a region associated with several neuropsychiatric disorders, is partially duplicated and forms a hybrid with a novel gene from the family with sequence similarity 7 (FAM7A). Alternative splicing has been observed, and two variants exist, for this hybrid gene. The N-terminally truncated products predicted by the largest open reading frames for each variant would lack the majority of the neurotransmitter-gated ion-channel ligand binding domain but retain the transmembrane region that forms the ion channel. Although current evidence supports transcription of this hybrid gene, translation of the nicotinic acetylcholine receptor-like protein-encoding open reading frames has not been confirmed. [provided by RefSeq, Jul 2008]
• Synonyms: CHRNA7; CHRNA7-DR1; D-10
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 92%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Other, Transmembrane