OriGene Logo

KCTD10 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA338717
Rabbit Polyclonal Anti-KCTD10 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $525.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY410399 Transient overexpression lysate of potassium channel tetramerisation domain containing 10 (KCTD10) 100 ug
$436.00
TP307723 Recombinant protein of human potassium channel tetramerisation domain containing 10 (KCTD10), 20 µg
20 ug
$737.00

View other "KCTD10 or NM_031954" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-KCTD10 antibody: synthetic peptide directed towards the N terminal of human KCTD10. Synthetic peptide located within the following region: MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 34 kDa
Gene Name potassium channel tetramerization domain containing 10
Database Link
Background Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex. The BCR(BACURD3) E3 ubiquitin ligase complex mediates the ubiquitination of target proteins, leading to their degradation by the proteasome.
Synonyms BTBD28; hBACURD3; MSTP028; ULRO61
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%; Zebrafish: 93%; Guinea pig: 93%
Reference Data
Protein Categories Intracellular Proteins
Protein Families Ion Channels: Other
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.