KCTD10 (NM_031954) Human Recombinant Protein

SKU
TP307723
Recombinant protein of human potassium channel tetramerisation domain containing 10 (KCTD10), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC207723 protein sequence
Red=Cloning site Green=Tags(s)

MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTLTKQDTMLKAMFSGRMEVLTD
SEGWILIDRCGKHFGTILNYLRDGAVPLPESRREIEELLAEAKYYLVQGLVEECQAALQNKDTYEPFCKV
PVITSSKEEQKLIATSNKPAVKLLYNRSNNKYSYTSNSDDNMLKNIELFDKLSLRFNGRVLFIKDVIGDE
ICCWSFYGQGRKIAEVCCTSIVYATEKKQTKVEFPEARIYEETLNILLYEAQDGRGPDNALLEATGGAAG
RSHHLDEDEERERIERVRRIHIKRPDDRAHLHQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_114160
Locus ID 83892
UniProt ID Q9H3F6
Cytogenetics 12q24.11
RefSeq Size 4057
RefSeq ORF 939
Synonyms BTBD28; hBACURD3; MSTP028; ULRO61
Summary The protein encoded by this gene binds proliferating cell nuclear antigen (PCNA) and may be involved in DNA synthesis and cell proliferation. In addition, the encoded protein may be a tumor suppressor. Several protein-coding and non-protein coding transcript variants have been found for this gene. [provided by RefSeq, Dec 2015]
Protein Families Ion Channels: Other
Write Your Own Review
You're reviewing:KCTD10 (NM_031954) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH307723 KCTD10 MS Standard C13 and N15-labeled recombinant protein (NP_114160) 10 ug
$3,255.00
LC410399 KCTD10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410399 Transient overexpression lysate of potassium channel tetramerisation domain containing 10 (KCTD10) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.