KCTD10 (NM_031954) Human Mass Spec Standard

SKU
PH307723
KCTD10 MS Standard C13 and N15-labeled recombinant protein (NP_114160)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207723]
Predicted MW 35.4 kDa
Protein Sequence
Protein Sequence
>RC207723 protein sequence
Red=Cloning site Green=Tags(s)

MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTLTKQDTMLKAMFSGRMEVLTD
SEGWILIDRCGKHFGTILNYLRDGAVPLPESRREIEELLAEAKYYLVQGLVEECQAALQNKDTYEPFCKV
PVITSSKEEQKLIATSNKPAVKLLYNRSNNKYSYTSNSDDNMLKNIELFDKLSLRFNGRVLFIKDVIGDE
ICCWSFYGQGRKIAEVCCTSIVYATEKKQTKVEFPEARIYEETLNILLYEAQDGRGPDNALLEATGGAAG
RSHHLDEDEERERIERVRRIHIKRPDDRAHLHQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_114160
RefSeq Size 4057
RefSeq ORF 939
Synonyms BTBD28; hBACURD3; MSTP028; ULRO61
Locus ID 83892
UniProt ID Q9H3F6
Cytogenetics 12q24.11
Summary The protein encoded by this gene binds proliferating cell nuclear antigen (PCNA) and may be involved in DNA synthesis and cell proliferation. In addition, the encoded protein may be a tumor suppressor. Several protein-coding and non-protein coding transcript variants have been found for this gene. [provided by RefSeq, Dec 2015]
Protein Families Ion Channels: Other
Write Your Own Review
You're reviewing:KCTD10 (NM_031954) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410399 KCTD10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410399 Transient overexpression lysate of potassium channel tetramerisation domain containing 10 (KCTD10) 100 ug
$436.00
TP307723 Recombinant protein of human potassium channel tetramerisation domain containing 10 (KCTD10), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.