OriGene Logo

FXYD7 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA338705
Rabbit Polyclonal Anti-FXYD7 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY411843 Transient overexpression lysate of FXYD domain containing ion transport regulator 7 (FXYD7) 100 ug
$436.00
TP305819 Recombinant protein of human FXYD domain containing ion transport regulator 7 (FXYD7), 20 µg
20 ug
$867.00

View other "FXYD7 or NM_022006" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-FXYD7 antibody: synthetic peptide directed towards the N terminal of human FXYD7. Synthetic peptide located within the following region: MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVK
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 8 kDa
Gene Name FXYD domain containing ion transport regulator 7
Database Link
Background This reference sequence was derived from multiple replicate ESTs and validated by similar human genomic sequence. This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. This gene product, FXYD7, is novel and has not been characterized as a protein. RefSeq curation by Kathleen J. Sweadner, Ph.D., sweadner@helix.mgh.harvard.edu., Dec 2000. ##Evidence-Data-START## Transcript exon combination :: BC018619.1, AK057825.1 ECO:0000332 RNAseq introns :: single sample supports all introns ERS025083, ERS025084 ECO:0000348 ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
Synonyms FLJ25096
Note Immunogen Sequence Homology: Human: 100%; Bovine: 77%
Reference Data
Protein Categories Membrane Proteins
Protein Families Ion Channels: Other, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.