GABRE Rabbit Polyclonal Antibody

CAT#: TA338704

Rabbit Polyclonal Anti-GABRE Antibody

Product Images

WB Suggested Anti-GABRE Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GABRE antibody: synthetic peptide directed towards the middle region of human GABRE. Synthetic peptide located within the following region: KNSWKLFQFDFTGVSNKTEIITTPVGDFMVMTIFFNVSRRFGYVAFQNYV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: gamma-aminobutyric acid type A receptor epsilon subunit
• Database Link:
  NP_068819
  Entrez Gene 2564 Human
  UniProt ID P78334
• Background: The product of this gene belongs to the ligand-gated ionic channel (TC 1.A.9) family. It encodes the gamma-aminobutyric acid (GABA) A receptor which is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes an epsilon subunit. It is mapped to chromosome Xq28 in a cluster comprised of genes encoding alpha 3, beta 4 and theta subunits of the same receptor. Alternatively spliced transcript variants have been identified, but only one is thought to encode a protein. [provided by RefSeq, Oct 2008]
• Synonyms: epsilon; GABA(A) receptor; gamma-aminobutyric acid (GABA) A receptor; OTTHUMP00000025892
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 92%; Rabbit: 86%; Mouse: 85%; Pig: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Cys-loop Receptors, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction