TRPV4 Rabbit Polyclonal Antibody

CAT#: TA338698

Reviews ()
Write a review

Rabbit Polyclonal Anti-TRPV4 Antibody

Product Datasheet for 'TA338698'

Promo! Get it for USD 289.00, only with code 289*.

(*) Valid from April 1st to September 30th, 2020. See details »

USD 375.00

5 Days

    • 100 ul

Product images


Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivity Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TRPV4 antibody: synthetic peptide directed towards the middle region of human TRPV4. Synthetic peptide located within the following region: RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration 1 mg/ml
Purification Protein A purified
Predicted Protein Size 91 kDa
Gene Name transient receptor potential cation channel subfamily V member 4
Background This gene encodes a member of the OSM9-like transient receptor potential channel (OTRPC) subfamily in the transient receptor potential (TRP) superfamily of ion channels. The encoded protein is a Ca2+-permeable, nonselective cation channel that is thought to be involved in the regulation of systemic osmotic pressure. Mutations in this gene are the cause of spondylometaphyseal and metatropic dysplasia and hereditary motor and sensory neuropathy type IIC. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2010]
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Dog: 86%; Mouse: 86%; Guinea pig: 86%
Reference Data
Protein Families Druggable Genome, Ion Channels: Transient receptor potential, Transmembrane
Other products for "TRPV4"
Frequently bought together (2)
Transient overexpression lysate of transient receptor potential cation channel, subfamily V, member 4 (TRPV4), transcript variant 2
    • 100 ug

USD 495.00

beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Customer Reviews 
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
Clone ID reveals the Source of Monoclonal Antibodies