TREML2 Rabbit Polyclonal Antibody

SKU
TA338680
Rabbit Polyclonal Anti-TREML2 Antibody
  $585.00
5 Days*
Bulk/Customize
Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TREML2 antibody: synthetic peptide directed towards the middle region of human TREML2. Synthetic peptide located within the following region: TGYSFTATSTTSQGPRRTMGSQTVTASPSNARDSSAGPESISTKSGDLST
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 41 kDa
Gene Name triggering receptor expressed on myeloid cells like 2
Database Link
Background TREML2 is a single-pass type I membrane protein, and it contains 1 Ig-like V-type (immunoglobulin-like) domain. TREML2 is a cell surface receptor that may play a role in the innate and adaptive immune response. TREML2 is located in a gene cluster on chromosome 6 with the single Ig variable (IgV) domain activating receptors TREM1 (MIM 605085) and TREM2 (MIM 605086), but it has distinct structural and functional properties (Allcock et al., 2003 PubMed 12645956). supplied by OMIM. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1294 AY358171.1 2-1295 1295-3758 AL133404.8 7920-10383
Synonyms C6orf76; dJ238O23.1; TLT-2; TLT2
Note Immunogen Sequence Homology: Human: 100%; Dog: 79%
Reference Data
Protein Categories Membrane Proteins
Protein Families Druggable Genome, Transmembrane
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.