ISLR2 Rabbit Polyclonal Antibody

SKU TA338443

Rabbit Polyclonal Anti-ISLR2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ISLR2 antibody: synthetic peptide directed towards the N terminal of human ISLR2. Synthetic peptide located within the following region: PFHCGCGLVWLQAWAASTRVSLPEPDSIACASPPALQGVPVYRLPALPCA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 79 kDa
• Gene Name: immunoglobulin superfamily containing leucine-rich repeat 2
• Database Link:
  NP_065902
  Q6UXK2
• Background: ISLR2 is a single-pass membrane protein. It contains 1 Ig-like (immunoglobulin-like) domain and 5 LRR (leucine-rich) repeats. The exact function of ISLR2 remains unknown.
• Synonyms: LINX
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane