SEMA6A Rabbit Polyclonal Antibody

SKU
TA338441
Rabbit Polyclonal Anti-SEMA6A Antibody
  $585.00
5 Days*
Bulk/Customize
Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SEMA6A antibody: synthetic peptide directed towards the middle region of human SEMA6A. Synthetic peptide located within the following region: ERVPKPRPGCCAGSSSLERYATSNEFPDDTLNFIKTHPLMDEAVPSIFNR
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 114 kDa
Gene Name semaphorin 6A
Database Link
Background SEMA6A can act as repulsive axon guidance cues. SEMA6A may play a role in channeling sympathetic axons into the sympathetic chains and controlling the temporal sequence of sympathetic target innervation.
Synonyms HT018; SEMA; SEMA6A1; SEMAQ; VIA
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%; Dog: 86%; Bovine: 86%; Rabbit: 86%
Reference Data
Protein Categories Growth Factors, Intracellular Proteins, Membrane Proteins
Protein Families Transmembrane
Protein Pathways Axon guidance
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.