Nceh1 Rabbit Polyclonal Antibody

SKU
TA338440
Rabbit Polyclonal Anti-Nceh1 Antibody
  $585.00
5 Days*
Bulk/Customize
Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human, Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Nceh1antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LQALDFNTPSYQQSMNTPILPRHVMVRYWLDYFKGNYDFVEAMIVNNHTS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 46 kDa
Gene Name neutral cholesterol ester hydrolase 1
Database Link
Background Nceh1is hydrolyzes 2-acetyl monoalkylglycerol ether, the penultimate precursor of the pathway for de novo synthesis of platelet-activating factor. It may be responsible for cholesterol ester hydrolysis in macrophages. It also involved in organ detoxification by hydrolyzing exogenous organophosphorus compounds.
Synonyms AADACL1; NCEH
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Categories Intracellular Proteins, Membrane Proteins
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.