TXNDC16 Rabbit Polyclonal Antibody

SKU TA338438

Rabbit Polyclonal Anti-TXNDC16 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TXNDC16 antibody: synthetic peptide directed towards the N terminal of human TXNDC16. Synthetic peptide located within the following region: EVAEDPQQVSTVHLQLGLPLVFIVSQQATYEADRRTAEWVAWRLLGKAGV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 93 kDa
• Gene Name: thioredoxin domain containing 16
• Database Link:
  NP_065835
  Q9P2K2
• Background: TXNDC16 contains 1 thioredoxin domain. The exact function of TXNDC16 remains unknown.
• Synonyms: ERp90; KIAA1344
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 86%; Bovine: 86%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane