MRS2 Rabbit Polyclonal Antibody

SKU TA338429

Rabbit Polyclonal Anti-MRS2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MRS2 antibody: synthetic peptide directed towards the middle region of human MRS2. Synthetic peptide located within the following region: LDALVDPKHSSVDRSKLHILLQNGKSLSELETDIKIFKESILEILDEEEL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 50 kDa
• Gene Name: MRS2, magnesium transporter
• Database Link:
  NP_065713
  Q9HD23
• Background: MRS2 is a magnesium transporter that may mediate the influx of magnesium into the mitochondrial matrix.
• Synonyms: HPT; MRS2L
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Goat: 93%; Rabbit: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Transcription Factors, Transmembrane