MRS2 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-MRS2 antibody: synthetic peptide directed towards the middle region of human MRS2. Synthetic peptide located within the following region: LDALVDPKHSSVDRSKLHILLQNGKSLSELETDIKIFKESILEILDEEEL |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 50 kDa |
| Gene Name | MRS2, magnesium transporter |
| Database Link | |
| Background | MRS2 is a magnesium transporter that may mediate the influx of magnesium into the mitochondrial matrix. |
| Synonyms | HPT; MRS2L |
| Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Goat: 93%; Rabbit: 93%; Guinea pig: 93% |
| Reference Data | |
| Protein Categories | Membrane Proteins |
| Protein Families | Transcription Factors, Transmembrane |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
N-Glycosylation of MRS2 balances aerobic and anaerobic energy production by reducing rapid mitochondrial Mg2+ influx in conditions of high glucose or impaired respiratory chain function
Peng, Mathew, Anderson et al
bioRxiv (2024)
Peng, Mathew, Anderson et al
bioRxiv (2024)
Cited by 1
Snippet: In the absence of lentiviral overexpression of MRS2, the Abcam and Origene antibodies reproducibly detected these bands. Further, the Novus antibody results;lonal rabbit antibodies against a 50-mer synthetic peptide derived from human MRS2 were purchased from Novus Biologicals (NBP2 34200), Abcam (ab90295, no longer available), Alomone labs (ANT-148) and Origene (TA338429). …
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
