IL22 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-IL22 antibody: synthetic peptide directed towards the C terminal of human IL22. Synthetic peptide located within the following region: CHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 20 kDa |
| Gene Name | interleukin 22 |
| Database Link | |
| Background | IL22 belongs to the IL-10 family. It is a cytokine that contributes to the inflammatory response in vivo. |
| Synonyms | IL-21; IL-22; IL-D110; IL-TIF; ILTIF; TIFa; TIFIL-23; zcyto18 |
| Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Goat: 93%; Horse: 93%; Sheep: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 92% |
| Reference Data | |
| Protein Categories | Cytokines, Secreated Proteins |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
| Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
Effects of frequent teat stimulation on antimicrobial component production in mammary glands of lactating goats
Tsugami, Harada, Nii et al
Vet Immunol Immunopathol (2022) 249, 110431 DOI: 10.1016/j.vetimm.2022.110431
Tsugami, Harada, Nii et al
Vet Immunol Immunopathol (2022) 249, 110431 DOI: 10.1016/j.vetimm.2022.110431
Cited by 8
AI Summary: In this study, OriGene's rabbit anti-IL-22 antibody (4C, TA338422) was used in a competitive ELISA to measure IL-22 concentrations in goat milk, helping to assess the impact of frequent teat stimulation on antimicrobial component production.
Snippet: Competitive ELISA was performed to measure lactoferrin and S100A7, as reported previously (Kuwahara et al., 2017). Competitive ELISA was performed to measure IL-22 using a rabbit anti-IL-22 antibody (4 C, TA338422;Origene Technologies Inc.) and a synthetic 44 amino acid sequence of IL-22 peptide (CHVESDNQ
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
