CACNB3 Rabbit Polyclonal Antibody

CAT#: TA338367

Rabbit Polyclonal Anti-CACNB3 Antibody

Antibody Service


 Product Datasheet for 'TA338367'

USD 360.00


Availability*
5 Days

Size
    • 100 ug

Product images

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Mouse, Dog, Pig, Horse, Human, Rabbit, Rat, Guinea pig, Bovine
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CACNB3 antibody: synthetic peptide directed towards the C terminal of human CACNB3. Synthetic peptide located within the following region: EHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPH
Isotype IgG
Formulation Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Protein A purified
Predicted Protein Size 53kDa
Gene Name calcium voltage-gated channel auxiliary subunit beta 3
Background This gene encodes a regulatory beta subunit of the voltage-dependent calcium channel. Beta subunits are composed of five domains, which contribute to the regulation of surface expression and gating of calcium channels and may also play a role in the regulation of transcription factors and calcium transport. [provided by RefSeq, Oct 2011].
Synonyms CAB3|CACNLB3
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families Ion Channels: Other, Druggable Genome
Protein Pathways MAPK signaling pathway, Cardiac muscle contraction, Hypertrophic cardiomyopathy (HCM), Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.