CACNG1 Rabbit Polyclonal Antibody

CAT#: TA338366

Rabbit Polyclonal Anti-Cacng1 Antibody

Product Images

WB Suggested Anti-Cacng1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: Rat Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Cacng1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: KNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSLGFIIIGSICAFL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: calcium voltage-gated channel auxiliary subunit gamma 1
• Database Link:
  NP_000718
  Entrez Gene 29658 Rat
  UniProt ID Q06432
• Background: calcium channel subunit involved in inactivation of calcium channel current [RGD, Feb 2006]. ##Evidence-Data-START## Transcript exon combination :: Y09453.1, FQ215004.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SRS369733, SRS369742 [ECO:0000348] ##Evidence-Data-END##
• Synonyms: CACNLG
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93%; Dog: 86%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Other, Transmembrane
• Protein Pathways: Arrhythmogenic right ventricular cardiomyopathy (ARVC), Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), MAPK signaling pathway