PGA3 Rabbit Polyclonal Antibody

CAT#: TA338326

Rabbit Polyclonal Anti-PGA3 Antibody

Product Images

WB Suggested Anti-PGA3 Antibody; Titration: 1.0 ug/ml; Positive Control: A549 Whole Cell PGA3 is supported by BioGPS gene expression data to be expressed in A549

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PGA3 antibody is: synthetic peptide directed towards the middle region of Human PGA3. Synthetic peptide located within the following region: ISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: pepsinogen 3, group I (pepsinogen A)
• Database Link:
  NP_001073275
  Entrez Gene 643834 Human
  UniProt ID P0DJD8
• Background: PGA3 shows particularly broad specificity; although bonds involving phenylalanine and leucine are preferred, many others are also cleaved to some extent.
• Synonyms: PGA4; PGA5
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 92%; Rat: 83%; Mouse: 83%

Reference Data

• Protein Families: Druggable Genome