OriGene Logo

GRIP2 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA338324
Rabbit Polyclonal Anti-GRIP2 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
2 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY421640 Transient overexpression lysate of glutamate receptor interacting protein 2 (GRIP2) 100 ug
$665.00

View other "GRIP2 or NM_001080423" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-GRIP2 antibody is: synthetic peptide directed towards the C-terminal region of Human GRIP2. Synthetic peptide located within the following region: IRLDNCPMEDAVQILRQCEDLVKLKIRKDEDNSDELETTGAVSYTVELKR
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 123 kDa
Gene Name glutamate receptor interacting protein 2
Database Link
Background GRIP2 may play a role as a localized scaffold for the assembly of a multiprotein signaling complex and as mediator of the trafficking of its binding partners at specific subcellular location in neurons.
Synonyms glutamate receptor interacting protein 2
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Zebrafish: 93%; Rat: 92%; Mouse: 92%; Rabbit: 92%; Guinea pig: 92%
Reference Data
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.