MTX3 Rabbit Polyclonal Antibody

SKU TA338290

Rabbit Polyclonal Anti-MTX3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MTX3 antibody is: synthetic peptide directed towards the N-terminal region of Human MTX3. Synthetic peptide located within the following region: VSQPAKILNFLRKQKYNADYELSAKQGADTLAYIALLEEKLLPAVLHTFW
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 27 kDa
• Gene Name: metaxin 3
• Database Link:
  NP_001161213
  Q5HYI7
• Background: The function of this protein remains unknown.
• Synonyms: DKFZp686O1788
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Mouse: 93%; Zebrafish: 93%; Guinea pig: 93%; Rabbit: 86%

Reference Data