GLUD1 Rabbit Polyclonal Antibody

CAT#: TA338163

Rabbit Polyclonal Anti-GLUD1 Antibody

Product Images

GLUD1 antibody - N-terminal region validated by WB using Fetal Liver Lysate at 1 ug/ml.

• 

  lanes 5: rat kidney cordex; lanes 6: rat kidney proximal tubules prepped from cortex; lanes 7: LLCPK-F+ pig kidney proximal tubule tissue culture lysate; lanes 8: rat brain supernatant

• 

  6Hum. Fetal Heart; Host: Rabbit; Target Name: GNAS; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

• 

  7Hum. Fetal Brain; Host: Rabbit; Target Name: NOP56; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

• 

  8Hum. Adult Placenta; Host: Rabbit; Target Name: SERPINA3; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: GLUD1; Sample Tissue: Human Fetal Liver; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 1 ug/ml; Peptide Concentration: 5 ug/ml; Lysate Quantity: 25 ug/lane/lane; Gel Conce

• Immunohistochemistry with pFa fixed human brain tissue tissue

• Immunohistochemistry with CORTEX/KIDNEY tissue

• Immunohistochemistry with pFA fixed human pancreas tissue tissue

Show all 9 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: glutamate dehydrogenase 1
• Database Link:
  NP_005262
  Entrez Gene 24399 RatEntrez Gene 2746 Human
  UniProt ID P00367
• Background: This gene encodes glutamate dehydrogenase protein; a mitochondrial matrix enzyme that catalyzes the oxidative deamination of glutamate to alpha-ketoglutarate and ammonia. This enzyme has an important role in regulating amino acid induced insulin secretion and activating mutations in this gene are a common cause of congenital hyperinsulinism. This enzyme is allosterically activated by ADP and inhibited by GTP and ATP. The related glutamate dehydrogenase 2 gene on the human X-chromosome originated from this gene via retrotransposition and encodes a soluble form of glutamate dehydrogenase. Multiple pseudogenes of this gene are present in humans. [provided by RefSeq, Sep 2009]
• Synonyms: GDH; GDH1; GLUD
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, D-Glutamine and D-glutamate metabolism, Metabolic pathways, Nitrogen metabolism