OriGene Logo

CD300C Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA338125
Rabbit Polyclonal Anti-CD300C Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY416481 Transient overexpression lysate of CD300c molecule (CD300C) 100 ug
$436.00

View other "CD300C or NM_006678" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CD300C antibody is: synthetic peptide directed towards the C-terminal region of Human CD300C. Synthetic peptide located within the following region: MGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVRFLLLVLLELPLL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 23 kDa
Gene Name CD300c molecule
Database Link
Background The CMRF35 antigen, which was identified by reactivity with a monoclonal antibody, is present on monocytes, neutrophils, and some T and B lymphocytes.
Synonyms CLM-6; CMRF-35; CMRF-35A; CMRF35; CMRF35-A1; CMRF35A; CMRF35A1; IGSF16; LIR
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Categories CD Markers, Membrane Proteins
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.