EIF2B2 Rabbit Polyclonal Antibody

CAT#: TA338093

Rabbit Polyclonal Anti-EIF2B2 Antibody

Product Images

WB Suggested Anti-EIF2B2 Antibody; Titration: 1.0 ug/ml; Positive Control: 293T Whole Cell EIF2B2 is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EIF2B2 antibody is: synthetic peptide directed towards the N-terminal region of Human EIF2B2. Synthetic peptide located within the following region: YGRLHGRSDESDQQESLHKLLTSGGLNEDFSFHYAQLQSNIIEAINELLV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: eukaryotic translation initiation factor 2B subunit beta
• Database Link:
  NP_055054
  Entrez Gene 8892 Human
  UniProt ID P49770
• Background: This gene encodes the beta subunit of eukaryotic initiation factor-2B (EIF2B). EIF2B is involved in protein synthesis and exchanges GDP and GTP for its activation and deactivation.
• Synonyms: EIF-2Bbeta; EIF2B
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%