MON2 Rabbit Polyclonal Antibody

CAT#: TA338068

Rabbit Polyclonal Anti-MON2 Antibody

Product Images

WB Suggested Anti-MON2 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MON2 antibody is: synthetic peptide directed towards the C-terminal region of Human MON2. Synthetic peptide located within the following region: SVAFHCLLDLVRGITSMIEGELGELETECQTTTEEGSSPTQSTEQQDLQS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 72 kDa
• Gene Name: MON2 homolog, regulator of endosome-to-Golgi trafficking
• Database Link:
  NP_055841
  Entrez Gene 23041 Human
  UniProt ID Q7Z3U7
• Background: The function of this protein remains unknown.
• Synonyms: KIAA1040; MGC35493
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 86%; Bovine: 86%; Dog: 79%