DSU (MREG) Rabbit Polyclonal Antibody

SKU TA338042

Rabbit Polyclonal Anti-MREG Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MREG antibody is: synthetic peptide directed towards the C-terminal region of Human MREG. Synthetic peptide located within the following region: DSLLSVTKLSTISDSKNTRKAREMLLKLAEETNIFPTSWELSERYLFVVD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 25 kDa
• Gene Name: melanoregulin
• Database Link:
  NP_060470
  Q8N565
• Background: MREG plays a role in the incorporation of pigments into hair. MREG may function in membrane fusion and regulate the biogenesis of disk membranes of photoreceptor rod cells.
• Synonyms: DSU; WDT2
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%

Reference Data