OriGene Logo

EHM2 (EPB41L4B) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA338037
Rabbit Polyclonal Anti-EPB41L4B Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY412741 Transient overexpression lysate of erythrocyte membrane protein band 4.1 like 4B (EPB41L4B), transcript variant 2 100 ug
$665.00

View other "EHM2 or NM_018424" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-EPB41L4B antibody is: synthetic peptide directed towards the middle region of Human EPB41L4B. Synthetic peptide located within the following region: AELGECELPEHTPELVSEFRFIPNQTEAMEFDIFQRWKECRGKSPAQAEL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 55 kDa
Gene Name erythrocyte membrane protein band 4.1 like 4B
Database Link
Background The function of this protein remains unknown.
Synonyms CG1; EHM2
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%; Zebrafish: 85%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.