SIRPG Rabbit Polyclonal Antibody

CAT#: TA338033

Rabbit Polyclonal Anti-SIRPG Antibody

Product Images

Host: Rabbit; Target Name: SIRPG; Sample Tissue: ACHN Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SIRPG antibody is: synthetic peptide directed towards the middle region of Human SIRPG. Synthetic peptide located within the following region: MDFSIRISSITPADVGTYYCVKFRKGSPENVEFKSGPGTEMALGAKPSA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: signal regulatory protein gamma
• Database Link:
  NP_061026
  Entrez Gene 55423 Human
  UniProt ID Q9P1W8
• Background: The protein encoded by this gene is a member of the signal-regulatory protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. Alternatively spliced transcript variants encoding different isoforms have been described.
• Synonyms: bA77C3.1; CD172g; SIRP-B2; SIRPB2; SIRPgamma
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Horse: 85%

Reference Data

• Protein Families: Druggable Genome, Transmembrane