ABHD6 Rabbit Polyclonal Antibody

SKU TA338020

Rabbit Polyclonal Anti-ABHD6 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ABHD6 antibody is: synthetic peptide directed towards the C-terminal region of Human ABHD6. Synthetic peptide located within the following region: MLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 38 kDa
• Gene Name: abhydrolase domain containing 6
• Database Link:
  NP_065727
  Q9BV23
• Background: ABHD6 has 2-arachidonoylglycerol hydrolase activity. ABHD6 may be a regulator of endocannabinoid signaling pathways.
• Synonyms: abhydrolase domain containing 6; lipase protein
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%; Rat: 86%; Mouse: 86%; Bovine: 86%; Dog: 79%

Reference Data

• Protein Families: Transmembrane