Chmp5 Rabbit Polyclonal Antibody

CAT#: TA337965

Rabbit Polyclonal Anti-Chmp5 Antibody

Product Images

Host: Rabbit; Target Name: Chmp5; Sample Tissue: Mouse Small Intestine lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Chmp5 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Chmp5. Synthetic peptide located within the following region: LDALGDELLADEDSSYLDEAASAPAIPEGVPTDTKNKDGVLVDEFGLPQI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: charged multivesicular body protein 5
• Database Link:
  NP_084090
  Entrez Gene 76959 Mouse
  UniProt ID Q9D7S9
• Background: Chmp5 is a probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis. ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4.
• Synonyms: C9orf83; CGI-34; HSPC177; hVps60; PNAS-2; SNF7DC2; Vps60
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 80%