CLNK Rabbit Polyclonal Antibody

SKU TA337939

Rabbit Polyclonal Anti-CLNK Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CLNK antibody is: synthetic peptide directed towards the C-terminal region of Human CLNK. Synthetic peptide located within the following region: SRQAVEEAFMKENKDGSFLVRDCSTKSKEEPYVLAVFYENKVYNVKIRFL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 49 kDa
• Gene Name: cytokine dependent hematopoietic cell linker
• Database Link:
  NP_443196
  Q7Z7G1
• Background: MIST is a member of the SLP76 family of adaptors. MIST plays a role in the regulation of immunoreceptor signaling, including PLC-gamma-mediated B cell antigen receptor (BCR) signaling and FC-epsilon R1-mediated mast cell degranulation.
• Synonyms: MIST
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Mouse: 93%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Bovine: 79%; Guinea pig: 79%

Reference Data