OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

YTHDC1 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA337926
Rabbit Polyclonal Anti-YTHDC1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (1)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00

View other "YTHDC1 or NM_133370" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-YTHDC1 antibody is: synthetic peptide directed towards the N-terminal region of Human YTHDC1. Synthetic peptide located within the following region: GKSATEYKNEEYQRSERNKRLDADRKIRLSSSASREPYKNQPEKTCVRKR
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 83 kDa
Gene Name YTH domain containing 1
Database Link
Background YTHDC1 may be part of a signal transduction pathway that influences splice site selection.
Synonyms YT521; YT521-B
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 92%; Yeast: 75%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

RNA m(6)A methylation regulates the ultraviolet-induced DNA damage response
Xiang, Laurent, Hsu et al
Nature (2017) 543 (7646), 573-576 DOI: 10.1038/nature21671
AI Summary: In this study, the αYTHDC1 antibody (OriGene Technologies, TA337926) was used for western blot analysis to investigate the role of m(6)A RNA modification in the ultraviolet-induced DNA damage response.
Snippet: Antibodies to POL δ1 (ABclonal A5323), POL δ3 (ABclonal, A7243), POL ε3 (ABclonal, A6469), POL η (Abcam, ab17725), POL ι (Sigma-Aldrich, HPA012000 or ABclonal, A1942), PARP1 (Trevigen, 4338-MC-50), PAR (TULIP BIOLABS, 1023), XPC (Santa Cruz, sc-74410), DDB2 (ABclonal, A1848), CSA (Santa Cruz, sc-10997), TFIIH/p89 (Santa Cruz, sc-293 (rabbit) or sc-377301 (mouse)), WTAP (Bethyl, A301-435A or A301-436A, or Santa Cruz, sc-374280), or FTO (Abcam, ab126605) were used at 3 μg/ml for IF. αYTHDC1 antibody (OriGene Technologies, TA337926) was used at 2 μg/ml for western blot
FigureFigureFigure
IF WB
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products