OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MBD3L1 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA337901
Rabbit Polyclonal Anti-MBD3L1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY407947 Transient overexpression lysate of methyl-CpG binding domain protein 3-like 1 (MBD3L1) (as WB positive control) 100 ug
$436.00
TP311313 Recombinant protein of human methyl-CpG binding domain protein 3-like 1 (MBD3L1), 20 µg
20 ug
$867.00

View other "MBD3L1 or NM_145208" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MBD3L1 antibody is: synthetic peptide directed towards the C-terminal region of Human MBD3L1. Synthetic peptide located within the following region: CKQFLVTEEDIRKQEGKVKTVRERLAIALIADGLANEAEKVRDQEGRPEK
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 21 kDa
Gene Name methyl-CpG binding domain protein 3 like 1
Database Link
Background This gene encodes a protein that is related to methyl-CpG-binding proteins but lacks the methyl-CpG binding domain. The protein is localized to discrete areas in the nucleus, and expression appears to be restricted to round spermatids, suggesting that the protein plays a role in the postmeiotic stages of male germ cell development.
Synonyms MBD3L
Note Immunogen Sequence Homology: Horse: 100%; Human: 100%; Zebrafish: 90%; Dog: 86%; Rat: 79%; Bovine: 79%; Pig: 75%; Mouse: 75%; Rabbit: 75%; Guinea pig: 75%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products