OriGene Logo

NKAIN4 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA337865
Rabbit Polyclonal Anti-NKAIN4 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY407181 Transient overexpression lysate of Na+/K+ transporting ATPase interacting 4 (NKAIN4) 100 ug
$436.00

View other "NKAIN4 or NM_152864" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NKAIN4 antibody: synthetic peptide directed towards the N terminal of human NKAIN4. Synthetic peptide located within the following region: MGSCSGRCALVVLCAFQLVAALERQVFDFLGYQWAPILANFVHIIIVILG
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 23 kDa
Gene Name Na+/K+ transporting ATPase interacting 4
Database Link
Background The specific function of NKAIN4 is not yet known.
Synonyms bA261N11.2; C20orf58; FAM77A
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Mouse: 93%; Pig: 92%; Bovine: 92%; Horse: 90%; Zebrafish: 86%; Guinea pig: 86%; Rat: 83%; Rabbit: 83%
Reference Data
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.