OriGene Logo

FBXO39 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA337849
Rabbit Polyclonal Anti-FBXO39 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY407156 Transient overexpression lysate of F-box protein 39 (FBXO39) 100 ug
$436.00

View other "FBXO39 or NM_153230" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-FBXO39 antibody: synthetic peptide directed towards the middle region of human FBXO39. Synthetic peptide located within the following region: RQCALRVFKARIYTNRYETNEEDKTLQEIYRKYRKLIESELSYFVIVYSV
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 53 kDa
Gene Name F-box protein 39
Database Link
Background FBXO39 is the substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXO39, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 PubMed 15520277). supplied by OMIM
Synonyms CT144; Fbx39
Note Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Pig: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%; Dog: 79%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.