Matriptase 2 (TMPRSS6) Rabbit Polyclonal Antibody

CAT#: TA337827

Rabbit Polyclonal Anti-TMPRSS6 Antibody

Product Images

WB Suggested Anti-TMPRSS6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Jurkat cell lysate

• 

  Liver

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 90 kDa
• Gene Name: transmembrane protease, serine 6
• Database Link:
  NP_705837
  Entrez Gene 164656 Human
  UniProt ID Q8IU80
• Background: TMPRSS6 is a serine protease which hydrolyzes a range of proteins including type I collagen, fibronectin and fibrinogen. TMPRSS6 can also activate urokinase-type plasminogen activator with low efficiency. TMPRSS6 may play a specialized role in matrix remodeling processes in liver. TMPRSS6 is required to sense iron deficiency. Overexpression of TMPRSS6 suppresses activation of the HAMP promoter.The protein encoded by this gene is a type II transmembrane serine proteinase that is found attached to the cell surface. The encoded protein may be involved in matrix remodeling processes in the liver.
• Synonyms: IRIDA
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Protease, Transmembrane