OriGene Logo

CREG2 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA337812
Rabbit Polyclonal Anti-CREG2 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY406921 Transient overexpression lysate of cellular repressor of E1A-stimulated genes 2 (CREG2) 100 ug
$436.00

View other "CREG2 or NM_153836" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CREG2 antibody: synthetic peptide directed towards the N terminal of human CREG2. Synthetic peptide located within the following region: VSSVSWAVTNEVDEELDSASTEEAMPALLEDSGSIWQQSFPASAHKEDAH
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 32 kDa
Gene Name cellular repressor of E1A stimulated genes 2
Database Link
Background The exact functions of CREG2 remain unknown.
Synonyms cellular repressor of E1A-stimulated genes 2
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 93%; Guinea pig: 93%
Reference Data
Protein Categories Secreated Proteins
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.