OriGene Logo

PLEKHH2 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA337802
Rabbit Polyclonal Anti-PLEKHH2 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY406819 Transient overexpression lysate of pleckstrin homology domain containing, family H (with MyTH4 domain) member 2 (PLEKHH2) 100 ug
$665.00

View other "PLEKHH2 or NM_172069" antibodies

Specifications
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PLEKHH2 antibody: synthetic peptide directed towards the C terminal of human PLEKHH2. Synthetic peptide located within the following region: WQLLALCVGLFLPHHPFLWLLRLHLKRNADSRTEFGKYAIYCQRCVERTQ
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 168 kDa
Gene Name pleckstrin homology, MyTH4 and FERM domain containing H2
Database Link
Background PLEKHH2 contains 1 FERM domain, 1 MyTH4 domain and 2 PH domains. It is a Single-pass membrane protein. The exact function of PLEKHH2 remains unknown.
Synonyms PLEKHH1L
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.