APLF Rabbit Polyclonal Antibody

SKU TA337774

Rabbit Polyclonal Anti-APLF Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-APLF antibody is: synthetic peptide directed towards the C-terminal region of Human APLF. Synthetic peptide located within the following region: NVLDEDNDNVGQPNEYDLNDSFLDDEEEDYEPTDEDSDWEPGKEDEEKED
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 57 kDa
• Gene Name: aprataxin and PNKP like factor
• Database Link:
  NP_775816
  Q8IW19
• Background: C2ORF13 is a component of the cellular response to chromosomal DNA single- and double-strand breaks.
• Synonyms: APFL; C2orf13; PALF; Xip1; ZCCHH1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 86%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Mouse: 79%

Reference Data