ZNF568 Rabbit Polyclonal Antibody

SKU TA337713

Rabbit Polyclonal Anti-ZNF568 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF568 antibody: synthetic peptide directed towards the N terminal of human ZNF568. Synthetic peptide located within the following region: VWEVDEQVKKQQETLVRKVTSISKKILIKEKVIECKKVAKIFPLSSDIVT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 44 kDa
• Gene Name: zinc finger protein 568
• Database Link:
  NP_940941
  Q3ZCX4
• Background: May be involved in transcriptional regulation.
• Synonyms: DKFZp667O0524; DKFZp686B0797; FLJ34820; FLJ35804
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 93%; Bovine: 93%

Reference Data

• Protein Families: Transcription Factors