Properdin (CFP) Rabbit Polyclonal Antibody

CAT#: TA337678

Rabbit Polyclonal Anti-CFP Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Transient overexpression lysate of complement factor properdin (CFP), transcript variant 2
    • 100 ug

USD 436.00

Other products for "Properdin"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CFP antibody: synthetic peptide directed towards the middle region of human CFP. Synthetic peptide located within the following region: SMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 48 kDa
Gene Name complement factor properdin
Background CFP is a plasma glycoprotein that positively regulates the alternative complement pathway of the innate immune system. This protein binds to many microbial surfaces and apoptotic cells and stabilizes the C3- and C5-convertase enzyme complexes in a feedbac
Synonyms BFD; PFC; PFD; PROPERDIN
Note Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Horse: 86%; Bovine: 83%; Dog: 79%; Pig: 79%; Guinea pig: 79%
Reference Data
Protein Families Secreted Protein

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.