PCOLCE Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-PCOLCE antibody: synthetic peptide directed towards the middle region of human PCOLCE. Synthetic peptide located within the following region: LLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKS |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 48 kDa |
| Gene Name | procollagen C-endopeptidase enhancer |
| Database Link | |
| Background | PCOLCE binds to the C-terminal propeptide of type I procollagen and enhances procollagen C-proteinase activity. |
| Synonyms | PCPE; PCPE-1; PCPE1 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 86% |
| Reference Data | |
| Protein Categories | Secreated Proteins |
| Protein Families | Secreted Protein |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
Heparanase Promotes Tumor Growth and Liver Metastasis of Colorectal Cancer Cells by Activating the p38/MMP1 Axis
Liu, Zhou, Li et al
Front Oncol (2019) 9, 216 DOI: 10.3389/fonc.2019.00216
Liu, Zhou, Li et al
Front Oncol (2019) 9, 216 DOI: 10.3389/fonc.2019.00216
AI Summary: OriGene’s PCOLCE antibody (TA337676) was used in this study to assess protein expression, contributing to the analysis of molecular changes following HPSE manipulation in colorectal cancer cells.
Snippet: phosphor-p38 (Cell Signaling, Beverly, MA, USA;1:2000, 4511), p38 (Cell Signaling;1:2000, 8690), MMP1 (Proteintech;1:1000, 10371-2-AP), PCOLCE (OriGene Tech, Rockville, MD, USA;0.5 μg/mL, TA337676), MMP10 (Abcam, Cambridge, MA, USA;1:1000, ab199688), CEACAM6 (Abcam;1:500, ab78029) and β-actin (Sigma- Aldrich, St Louis, MO, USA;1:5000, A5316)
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
