Micos13 Rabbit Polyclonal Antibody

SKU TA337628

Rabbit Polyclonal Anti-2410015M20Rik Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-2410015M20Rik antibody is: synthetic peptide directed towards the C-terminal region of 2410015M20Rik. Synthetic peptide located within the following region: TGLEMPQLPTPPKIKFPNFRDSWNSGIISVMSALSVAPSKAREYSKEGWE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 13 kDa
• Gene Name: RIKEN cDNA 2410015M20 gene
• Database Link:
  NP_694792
  Q8R404
• Background: The function of this protein remains unknown.
• Synonyms: QIL1
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Horse: 93%; Dog: 86%; Bovine: 86%; Guinea pig: 86%; Rat: 79%

Reference Data