ODF3L1 Rabbit Polyclonal Antibody

CAT#: TA337559

Rabbit Polyclonal Anti-ODF3L1 Antibody

Product Images

WB Suggested Anti-ODF3L1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ODF3L1 antibody: synthetic peptide directed towards the N terminal of human ODF3L1. Synthetic peptide located within the following region: KLPKGTRSSVYFAQHPEKEPLPSRQEVKQTPVIMAKIKGPGPAKYLRPSC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: outer dense fiber of sperm tails 3 like 1
• Database Link:
  NP_787077
  Entrez Gene 161753 Human
  UniProt ID Q8IXM7
• Background: The exact function of ODF3L1 remains unknown.
• Synonyms: MGC48986
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Guinea pig: 86%; Rat: 80%