OR5C1 Rabbit Polyclonal Antibody

CAT#: TA337521

Rabbit Polyclonal Anti-OR5C1 Antibody

Product Images

Host: Rabbit; Target Name: OR5C1; Sample Tissue: Hela Whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-OR5C1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5C1. Synthetic peptide located within the following region: SSSYALDTDKMASVFYTLVIPSLNPLIYSLRNKEVKEALRQTWSRFHCPG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: olfactory receptor family 5 subfamily C member 1
• Database Link:
  NP_001001923
  Entrez Gene 392391 Human
  UniProt ID Q8NGR4
• Background: The function of this protein remains unknown.
• Synonyms: OR5C2P; OR9-31; OR9-F
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Olfactory transduction